| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
| Protein automated matches [190826] (22 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries) |
| Domain d4qnkh1: 4qnk H:9-95 [274245] Other proteins in same PDB: d4qnka2, d4qnkb2, d4qnkc2, d4qnkd2, d4qnke2, d4qnkf2, d4qnkg2, d4qnkh2 automated match to d4mu3a1 complexed with edo, mn, na, po4 |
PDB Entry: 4qnk (more details), 1.75 Å
SCOPe Domain Sequences for d4qnkh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qnkh1 d.14.1.0 (H:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
hiddhhtnedvalaigtallkalgerk
Timeline for d4qnkh1: