SCOPe 2.05: Domain d4odvl2: 4odv L:108-213

Lineage for d4odvl2 (4odv L:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)

8. Domain d4odvl2: 4odv L:108-213 [274240]
   Other proteins in same PDB: d4odvl1
   automated match to d1h3pl2
   complexed with peg

Details for d4odvl2

PDB Entry: 4odv, 2.15 Å

PDB Description: fab structure of lipid a-specific antibody a6 in complex with lipid a carbohydrate backbone

PDB Compounds: (L:) A6 Fab (IgG2b kappa) light chain

SCOPe Domain Sequences for d4odvl2:

Sequence; same for both SEQRES and ATOM records:

>d4odvl2 b.1.1.2 (L:108-213) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4odvl2:

• d4odvl2 is new in SCOPe 2.05-stable
  
• d4odvl2 appears in SCOPe 2.06
  
• d4odvl2 appears in the current release, SCOPe 2.08