SCOPe 2.08: Domain d4odub2: 4odu B:108-212

Lineage for d4odub2 (4odu B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4odub2: 4odu B:108-212 [274238]
   Other proteins in same PDB: d4odua_, d4odub1, d4oduh_, d4odul1
   automated match to d2v7ha2
   complexed with so4

Details for d4odub2

PDB Entry: 4odu, 2.29 Å

PDB Description: unliganded fab structure of lipid a-specific antibody s1-15

PDB Compounds: (B:) S1-15 Fab (IgG2b kappa) light chain

SCOPe Domain Sequences for d4odub2:

Sequence; same for both SEQRES and ATOM records:

>d4odub2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4odub2:

• d4odub2 first appeared in SCOPe 2.05
  
• d4odub2 appears in SCOPe 2.07