Lineage for d4odub2 (4odu B:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752886Domain d4odub2: 4odu B:108-212 [274238]
    Other proteins in same PDB: d4odua_, d4odub1, d4oduh_, d4odul1
    automated match to d2v7ha2
    complexed with so4

Details for d4odub2

PDB Entry: 4odu (more details), 2.29 Å

PDB Description: unliganded fab structure of lipid a-specific antibody s1-15
PDB Compounds: (B:) S1-15 Fab (IgG2b kappa) light chain

SCOPe Domain Sequences for d4odub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4odub2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4odub2:

Click to download the PDB-style file with coordinates for d4odub2.
(The format of our PDB-style files is described here.)

Timeline for d4odub2: