SCOPe 2.08: Domain d4odwb2: 4odw B:108-213

Lineage for d4odwb2 (4odw B:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4odwb2: 4odw B:108-213 [274234]
   Other proteins in same PDB: d4odwb1, d4odwl1
   automated match to d1h3pl2
   complexed with trs

Details for d4odwb2

PDB Entry: 4odw, 2.72 Å

PDB Description: unliganded fab structure of lipid a-specific antibody a6

PDB Compounds: (B:) A6 Fab (IgG2b kappa) light chain

SCOPe Domain Sequences for d4odwb2:

Sequence; same for both SEQRES and ATOM records:

>d4odwb2 b.1.1.2 (B:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4odwb2:

• d4odwb2 first appeared in SCOPe 2.05
  
• d4odwb2 appears in SCOPe 2.07