SCOPe 2.06: Domain d4p7ua1: 4p7u A:27-127

Lineage for d4p7ua1 (4p7u A:27-127)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
   elaborated with additional structures resulting in a beta-sandwich fold

7. Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)

8. Domain d4p7ua1: 4p7u A:27-127 [274229]
   Other proteins in same PDB: d4p7ua2
   automated match to d1m9za_
   complexed with 1ps

Details for d4p7ua1

PDB Entry: 4p7u, 1.5 Å

PDB Description: extracellular domain of type ii transforming growth factor beta receptor in complex with ndsb-201

PDB Compounds: (A:) TGF-beta receptor type-2

SCOPe Domain Sequences for d4p7ua1:

Sequence; same for both SEQRES and ATOM records:

>d4p7ua1 g.7.1.3 (A:27-127) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
lckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklpyh
dfiledaasptcimkekkkpgetffmcscssdecndniifs

Timeline for d4p7ua1:

• d4p7ua1 first appeared in SCOPe 2.05, called d4p7ua_
  
• d4p7ua1 appears in SCOPe 2.07
  
• d4p7ua1 appears in the current release, SCOPe 2.08