Lineage for d5c1ib_ (5c1i B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895081Species Thermus thermophilus [TaxId:262724] [231176] (3 PDB entries)
  8. 2895088Domain d5c1ib_: 5c1i B: [274217]
    automated match to d2pwya_
    complexed with so4; mutant

Details for d5c1ib_

PDB Entry: 5c1i (more details), 3.1 Å

PDB Description: m1a58 trna methyltransferase mutant - d170a
PDB Compounds: (B:) tRNA (adenine(58)-N(1))-methyltransferase TrmI

SCOPe Domain Sequences for d5c1ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c1ib_ c.66.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
gplllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptle
eyllhmkrsatptypkdasamvtlldlapgmrvleagtgsggltlflaravgekglvesy
earphhlaqaernvrafwqvenvrfhlgkleeaeleeaaydgvalalmepwkvlekaala
lkpdrflvaylpnitqvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghta
flvalrrwkgs

SCOPe Domain Coordinates for d5c1ib_:

Click to download the PDB-style file with coordinates for d5c1ib_.
(The format of our PDB-style files is described here.)

Timeline for d5c1ib_: