Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoA [52612] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52613] (26 PDB entries) Uniprot P61586 2-181 |
Domain d5bwma_: 5bwm A: [274215] Other proteins in same PDB: d5bwmb_ automated match to d1cxza_ complexed with edo, gdp, mg, nai |
PDB Entry: 5bwm (more details), 2.5 Å
SCOPe Domain Sequences for d5bwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bwma_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} airkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtag qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal
Timeline for d5bwma_: