SCOPe 2.06: Domain d5c0na_: 5c0n A:

Lineage for d5c0na_ (5c0n A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d5c0na_: 5c0n A: [274214]
   automated match to d2qm9a_

Details for d5c0na_

PDB Entry: 5c0n, 3 Å

PDB Description: development of a monoclonal antibody targeting secreted ap2 to treat diabetes and fatty liver disease

PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5c0na_:

Sequence; same for both SEQRES and ATOM records:

>d5c0na_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

Timeline for d5c0na_:

• d5c0na_ first appeared in SCOPe 2.05
  
• d5c0na_ appears in SCOPe 2.07
  
• d5c0na_ appears in the current release, SCOPe 2.08