Lineage for d5byub_ (5byu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944431Species Legionella pneumophila [TaxId:272624] [274202] (2 PDB entries)
  8. 2944433Domain d5byub_: 5byu B: [274207]
    automated match to d2o6ua_
    complexed with coa

Details for d5byub_

PDB Entry: 5byu (more details), 2.4 Å

PDB Description: crystal structure of unnamed thioesterase ipg2867 from legionella pneumophila
PDB Compounds: (B:) thioesterase

SCOPe Domain Sequences for d5byub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5byub_ d.38.1.0 (B:) automated matches {Legionella pneumophila [TaxId: 272624]}
einkiihkktfdiawgdmdalghvnnaryfdyfqearidwlreldikmtgqtgpvvihva
ctflkpivypatvtihskvnslgnssmimdhdlyqeetlmaqgvskivwidytqnksvpl
pdiirnlv

SCOPe Domain Coordinates for d5byub_:

Click to download the PDB-style file with coordinates for d5byub_.
(The format of our PDB-style files is described here.)

Timeline for d5byub_: