SCOPe 2.08: Domain d5bxid1: 5bxi D:3-155

Lineage for d5bxid1 (5bxi D:3-155)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries)

8. Domain d5bxid1: 5bxi D:3-155 [274199]
   Other proteins in same PDB: d5bxid2, d5bxig2
   automated match to d4o0nb_
   complexed with bct, peg

Details for d5bxid1

PDB Entry: 5bxi, 1.7 Å

PDB Description: 1.7 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii with tyrosine of tag bound to active site

PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5bxid1:

Sequence; same for both SEQRES and ATOM records:

>d5bxid1 d.58.6.1 (D:3-155) automated matches {Toxoplasma gondii [TaxId: 508771]}
akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
dsvesankeislwftpeeicewtsaqhkwvyeq

Timeline for d5bxid1:

• d5bxid1 first appeared in SCOPe 2.05, called d5bxid_
  
• d5bxid1 appears in SCOPe 2.07