Lineage for d5bxik_ (5bxi K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951586Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries)
  8. 2951597Domain d5bxik_: 5bxi K: [274191]
    Other proteins in same PDB: d5bxid2, d5bxig2
    automated match to d4o0nb_
    complexed with bct, peg

Details for d5bxik_

PDB Entry: 5bxi (more details), 1.7 Å

PDB Description: 1.7 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii with tyrosine of tag bound to active site
PDB Compounds: (K:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5bxik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxik_ d.58.6.1 (K:) automated matches {Toxoplasma gondii [TaxId: 508771]}
akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
dsvesankeislwftpeeicewtsaqhkwvye

SCOPe Domain Coordinates for d5bxik_:

Click to download the PDB-style file with coordinates for d5bxik_.
(The format of our PDB-style files is described here.)

Timeline for d5bxik_: