![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries) |
![]() | Domain d5bxib_: 5bxi B: [274190] Other proteins in same PDB: d5bxid2, d5bxig2 automated match to d4o0nb_ complexed with bct, peg |
PDB Entry: 5bxi (more details), 1.7 Å
SCOPe Domain Sequences for d5bxib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxib_ d.58.6.1 (B:) automated matches {Toxoplasma gondii [TaxId: 508771]} akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs dsvesankeislwftpeeicewtsaqhkwvyeq
Timeline for d5bxib_: