Lineage for d1ei5a1 (1ei5 A:336-417)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2416072Superfamily b.61.3: D-aminopeptidase, middle and C-terminal domains [50886] (1 family) (S)
  5. 2416073Family b.61.3.1: D-aminopeptidase, middle and C-terminal domains [50887] (1 protein)
  6. 2416074Protein D-aminopeptidase, middle and C-terminal domains [50888] (1 species)
    duplication: both domains have this barrel fold
  7. 2416075Species Ochrobactrum anthropi [TaxId:529] [50889] (1 PDB entry)
  8. 2416076Domain d1ei5a1: 1ei5 A:336-417 [27418]
    Other proteins in same PDB: d1ei5a3

Details for d1ei5a1

PDB Entry: 1ei5 (more details), 1.9 Å

PDB Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi
PDB Compounds: (A:) d-aminopeptidase

SCOPe Domain Sequences for d1ei5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei5a1 b.61.3.1 (A:336-417) D-aminopeptidase, middle and C-terminal domains {Ochrobactrum anthropi [TaxId: 529]}
evsrveadsawfgswlddetglvlsledaghgrmkarfgtspemmdvvsanearsavtti
rrdgetielvrasenlrlsmkr

SCOPe Domain Coordinates for d1ei5a1:

Click to download the PDB-style file with coordinates for d1ei5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ei5a1: