Lineage for d5brxe_ (5brx E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811220Domain d5brxe_: 5brx E: [274179]
    automated match to d3sioc_
    complexed with pg4, so4, ti4

Details for d5brxe_

PDB Entry: 5brx (more details), 2.05 Å

PDB Description: x-ray crystal structure of aplysia californica (ac-achbp) in complex with 2-pyridyl azatricyclo[3.3.1.13,7]decane; 2-pyridylazaadamantane; 2-aza (ti-8480)
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5brxe_:

Sequence, based on SEQRES records: (download)

>d5brxe_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvy
weqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgs
vmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyassky
eilsatqtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d5brxe_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ddddklhsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqq
rwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfi
paqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeils
atqtrqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d5brxe_:

Click to download the PDB-style file with coordinates for d5brxe_.
(The format of our PDB-style files is described here.)

Timeline for d5brxe_: