Lineage for d5brxg1 (5brx G:1-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820144Domain d5brxg1: 5brx G:1-207 [274175]
    Other proteins in same PDB: d5brxa2, d5brxb2, d5brxc2, d5brxd2, d5brxe2, d5brxf2, d5brxg2, d5brxh2, d5brxi2, d5brxj2
    automated match to d3sioc_
    complexed with pg4, so4, ti4

Details for d5brxg1

PDB Entry: 5brx (more details), 2.05 Å

PDB Description: x-ray crystal structure of aplysia californica (ac-achbp) in complex with 2-pyridyl azatricyclo[3.3.1.13,7]decane; 2-pyridylazaadamantane; 2-aza (ti-8480)
PDB Compounds: (G:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5brxg1:

Sequence, based on SEQRES records: (download)

>d5brxg1 b.96.1.0 (G:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d5brxg1 b.96.1.0 (G:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwkln
slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl
sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr
qvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d5brxg1:

Click to download the PDB-style file with coordinates for d5brxg1.
(The format of our PDB-style files is described here.)

Timeline for d5brxg1: