Lineage for d1smpi_ (1smp I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2416046Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) (S)
  5. 2416047Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein)
    automatically mapped to Pfam PF02974
  6. 2416048Protein Metalloprotease inhibitor [50884] (2 species)
  7. 2416049Species Erwinia chrysanthemi [TaxId:556] [50885] (1 PDB entry)
  8. 2416050Domain d1smpi_: 1smp I: [27417]
    Other proteins in same PDB: d1smpa1, d1smpa2
    complexed with ca, zn

Details for d1smpi_

PDB Entry: 1smp (more details), 2.3 Å

PDB Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi
PDB Compounds: (I:) erwinia chrysanthemi inhibitor

SCOPe Domain Sequences for d1smpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smpi_ b.61.2.1 (I:) Metalloprotease inhibitor {Erwinia chrysanthemi [TaxId: 556]}
sslrlpsaaelsgqwvlsgaeqhcdirlntdvldgttwklagdtaclqkllpeapvgwrp
tpdgltltqadgsavaffsrnrdryehklvdgsvrtlkkk

SCOPe Domain Coordinates for d1smpi_:

Click to download the PDB-style file with coordinates for d1smpi_.
(The format of our PDB-style files is described here.)

Timeline for d1smpi_: