SCOPe 2.05: Domain d5bp0c_: 5bp0 C:

Lineage for d5bp0c_ (5bp0 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (3 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (19 PDB entries)

8. Domain d5bp0c_: 5bp0 C: [274166]
   automated match to d4alxa_
   complexed with fn1, nag, po4

Details for d5bp0c_

PDB Entry: 5bp0, 2.4 Å

PDB Description: x-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) in complex with 5-fluoronicotine (ti-4650)

PDB Compounds: (C:) acetylcholine-binding protein

SCOPe Domain Sequences for d5bp0c_:

Sequence, based on SEQRES records:

>d5bp0c_ b.96.1.1 (C:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
ildvtqkknsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records):

>d5bp0c_ b.96.1.1 (C:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildv
tqkknsvtysccpeayedvevslnfrkk

Timeline for d5bp0c_:

• d5bp0c_ is new in SCOPe 2.05-stable
  
• d5bp0c_ is called d5bp0c1 in SCOPe 2.06
  
• d5bp0c_ appears in the current release, SCOPe 2.08, called d5bp0c1