Lineage for d1aveb_ (1ave B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113687Fold b.61: Streptavidin-like [50875] (4 superfamilies)
  4. 113688Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 113689Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 113690Protein Avidin [50880] (1 species)
  7. 113691Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)
  8. 113703Domain d1aveb_: 1ave B: [27416]

Details for d1aveb_

PDB Entry: 1ave (more details), 2.8 Å

PDB Description: crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties

SCOP Domain Sequences for d1aveb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aveb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

SCOP Domain Coordinates for d1aveb_:

Click to download the PDB-style file with coordinates for d1aveb_.
(The format of our PDB-style files is described here.)

Timeline for d1aveb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1avea_