SCOP 1.57: Domain d1aveb_: 1ave B:

Lineage for d1aveb_ (1ave B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.61: Streptavidin-like [50875] (3 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)

8. Domain d1aveb_: 1ave B: [27416]

Details for d1aveb_

PDB Entry: 1ave, 2.8 Å

PDB Description: crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties

SCOP Domain Sequences for d1aveb_:

Sequence; same for both SEQRES and ATOM records:

>d1aveb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

Timeline for d1aveb_:

• d1aveb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aveb_ appears in SCOP 1.59
  
• d1aveb_ appears in the current release, SCOPe 2.08