SCOPe 2.08: Domain d1aveb_: 1ave B:

Lineage for d1aveb_ (1ave B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)

8. Domain d1aveb_: 1ave B: [27416]
   complexed with nag

Details for d1aveb_

PDB Entry: 1ave, 2.8 Å

PDB Description: crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1aveb_:

Sequence; same for both SEQRES and ATOM records:

>d1aveb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

Timeline for d1aveb_:

• d1aveb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aveb_ appears in SCOPe 2.07