![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93062] [225575] (13 PDB entries) |
![]() | Domain d4zxug1: 4zxu G:1-496 [274152] Other proteins in same PDB: d4zxua2, d4zxub2, d4zxue2, d4zxug2 automated match to d4qn2a_ complexed with nad, so4; mutant |
PDB Entry: 4zxu (more details), 2.85 Å
SCOPe Domain Sequences for d4zxug1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zxug1 c.82.1.0 (G:1-496) automated matches {Staphylococcus aureus [TaxId: 93062]} mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkh imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag avfskdigkaqrvanklklgtvwindffmyfaqapwggykqsgigrelgkegleeylvsk hiltntnpqlvnwfsk
Timeline for d4zxug1: