Lineage for d4zxug1 (4zxu G:1-496)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909970Species Staphylococcus aureus [TaxId:93062] [225575] (13 PDB entries)
  8. 2910040Domain d4zxug1: 4zxu G:1-496 [274152]
    Other proteins in same PDB: d4zxua2, d4zxub2, d4zxue2, d4zxug2
    automated match to d4qn2a_
    complexed with nad, so4; mutant

Details for d4zxug1

PDB Entry: 4zxu (more details), 2.85 Å

PDB Description: 2.85 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) h448f/p449m double mutant from staphylococcus aureus in complex with nad+ and bme-free cys289
PDB Compounds: (G:) Betaine-aldehyde dehydrogenase

SCOPe Domain Sequences for d4zxug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zxug1 c.82.1.0 (G:1-496) automated matches {Staphylococcus aureus [TaxId: 93062]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindffmyfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

SCOPe Domain Coordinates for d4zxug1:

Click to download the PDB-style file with coordinates for d4zxug1.
(The format of our PDB-style files is described here.)

Timeline for d4zxug1: