SCOP 1.69: Domain d1avea_: 1ave A:

Lineage for d1avea_ (1ave A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.61: Streptavidin-like [50875] (6 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)

8. Domain d1avea_: 1ave A: [27415]

Details for d1avea_

PDB Entry: 1ave, 2.8 Å

PDB Description: crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties

SCOP Domain Sequences for d1avea_:

Sequence; same for both SEQRES and ATOM records:

>d1avea_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

Timeline for d1avea_:

• d1avea_ first appeared (with stable ids) in SCOP 1.55
  
• d1avea_ appears in SCOP 1.67
  
• d1avea_ appears in SCOP 1.71
  
• d1avea_ appears in the current release, SCOPe 2.08