Lineage for d1avea_ (1ave A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16670Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 16671Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 16672Protein Avidin [50880] (1 species)
  7. 16673Species Chicken (Gallus gallus) [TaxId:9031] [50881] (5 PDB entries)
  8. 16682Domain d1avea_: 1ave A: [27415]

Details for d1avea_

PDB Entry: 1ave (more details), 2.8 Å

PDB Description: crystal structure of hen egg-white apo-avidin in relation to its thermal stability properties

SCOP Domain Sequences for d1avea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avea_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

SCOP Domain Coordinates for d1avea_:

Click to download the PDB-style file with coordinates for d1avea_.
(The format of our PDB-style files is described here.)

Timeline for d1avea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aveb_