Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Escherichia coli [TaxId:83334] [274143] (1 PDB entry) |
Domain d4zv9c1: 4zv9 C:60-294 [274147] Other proteins in same PDB: d4zv9a2, d4zv9b2, d4zv9c2, d4zv9d2, d4zv9e2, d4zv9f2 automated match to d4u2ca_ complexed with gol, peg, pge, po4 |
PDB Entry: 4zv9 (more details), 2 Å
SCOPe Domain Sequences for d4zv9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zv9c1 c.69.1.0 (C:60-294) automated matches {Escherichia coli [TaxId: 83334]} qveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyiedvar rvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqatgk vgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtrineg wpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl
Timeline for d4zv9c1: