Lineage for d4zv9a1 (4zv9 A:60-294)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (103 species)
    not a true protein
  7. 2476647Species Escherichia coli [TaxId:83334] [274143] (1 PDB entry)
  8. 2476648Domain d4zv9a1: 4zv9 A:60-294 [274146]
    Other proteins in same PDB: d4zv9a2, d4zv9b2, d4zv9c2, d4zv9d2, d4zv9e2, d4zv9f2
    automated match to d4u2ca_
    complexed with gol, peg, pge, po4

Details for d4zv9a1

PDB Entry: 4zv9 (more details), 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4zv9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zv9a1 c.69.1.0 (A:60-294) automated matches {Escherichia coli [TaxId: 83334]}
qveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyiedvar
rvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqatgk
vgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtrineg
wpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl

SCOPe Domain Coordinates for d4zv9a1:

Click to download the PDB-style file with coordinates for d4zv9a1.
(The format of our PDB-style files is described here.)

Timeline for d4zv9a1: