SCOPe 2.06: Domain d4zv9b1: 4zv9 B:60-294

Lineage for d4zv9b1 (4zv9 B:60-294)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [274143] (1 PDB entry)

8. Domain d4zv9b1: 4zv9 B:60-294 [274145]
   Other proteins in same PDB: d4zv9a2, d4zv9b2, d4zv9c2, d4zv9d2, d4zv9e2, d4zv9f2
   automated match to d4u2ca_
   complexed with gol, peg, pge, po4

Details for d4zv9b1

PDB Entry: 4zv9, 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d4zv9b1:

Sequence; same for both SEQRES and ATOM records:

>d4zv9b1 c.69.1.0 (B:60-294) automated matches {Escherichia coli [TaxId: 83334]}
qveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyiedvar
rvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqatgk
vgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtrineg
wpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl

Timeline for d4zv9b1:

• d4zv9b1 first appeared in SCOPe 2.05, called d4zv9b_
  
• d4zv9b1 appears in SCOPe 2.07
  
• d4zv9b1 appears in the current release, SCOPe 2.08