SCOPe 2.08: Domain d4zria2: 4zri A:104-214

Lineage for d4zria2 (4zri A:104-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries)

8. Domain d4zria2: 4zri A:104-214 [274141]
   Other proteins in same PDB: d4zria1, d4zria3, d4zrib1, d4zrib3
   automated match to d1h4ra1

Details for d4zria2

PDB Entry: 4zri, 2.7 Å

PDB Description: crystal structure of merlin-ferm and lats2

PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d4zria2:

Sequence; same for both SEQRES and ATOM records:

>d4zria2 a.11.2.0 (A:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Timeline for d4zria2:

• d4zria2 first appeared in SCOPe 2.05
  
• d4zria2 appears in SCOPe 2.07