SCOPe 2.07: Domain d1avdb_: 1avd B:

Lineage for d1avdb_ (1avd B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (14 PDB entries)

8. Domain d1avdb_: 1avd B: [27414]
   complexed with btn, nag

Details for d1avdb_

PDB Entry: 1avd, 2.7 Å

PDB Description: three-dimensional structure of the tetragonal crystal form of egg- white avidin in its functional complex with biotin at 2.7 angstroms resolution

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1avdb_:

Sequence; same for both SEQRES and ATOM records:

>d1avdb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt

Timeline for d1avdb_:

• d1avdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1avdb_ appears in SCOPe 2.06
  
• d1avdb_ appears in the current release, SCOPe 2.08