Lineage for d1avdb_ (1avd B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170131Protein Avidin [50880] (1 species)
  7. 170132Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)
  8. 170142Domain d1avdb_: 1avd B: [27414]

Details for d1avdb_

PDB Entry: 1avd (more details), 2.7 Å

PDB Description: three-dimensional structure of the tetragonal crystal form of egg- white avidin in its functional complex with biotin at 2.7 angstroms resolution

SCOP Domain Sequences for d1avdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avdb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt

SCOP Domain Coordinates for d1avdb_:

Click to download the PDB-style file with coordinates for d1avdb_.
(The format of our PDB-style files is described here.)

Timeline for d1avdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1avda_