SCOPe 2.05: Domain d4zrib3: 4zri B:215-311

Lineage for d4zrib3 (4zri B:215-311)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)

8. Domain d4zrib3: 4zri B:215-311 [274139]
   Other proteins in same PDB: d4zria1, d4zria2, d4zrib1, d4zrib2
   automated match to d1h4ra2

Details for d4zrib3

PDB Entry: 4zri, 2.7 Å

PDB Description: crystal structure of merlin-ferm and lats2

PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d4zrib3:

Sequence; same for both SEQRES and ATOM records:

>d4zrib3 b.55.1.0 (B:215-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrr

Timeline for d4zrib3:

• d4zrib3 is new in SCOPe 2.05-stable
  
• d4zrib3 appears in SCOPe 2.06
  
• d4zrib3 appears in the current release, SCOPe 2.08