![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries) |
![]() | Domain d4zrja2: 4zrj A:104-214 [274135] Other proteins in same PDB: d4zrja1, d4zrja3 automated match to d1ni2a1 complexed with gol |
PDB Entry: 4zrj (more details), 2.3 Å
SCOPe Domain Sequences for d4zrja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrja2 a.11.2.0 (A:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d4zrja2: