![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (11 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189205] (6 PDB entries) |
![]() | Domain d4zrka1: 4zrk A:20-103 [274130] Other proteins in same PDB: d4zrka2, d4zrka3, d4zrkb2, d4zrkb3, d4zrkc2, d4zrkc3, d4zrkd2, d4zrkd3 automated match to d1h4ra3 |
PDB Entry: 4zrk (more details), 2.32 Å
SCOPe Domain Sequences for d4zrka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrka1 d.15.1.0 (A:20-103) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk kvldhdvskeepvtfhflakfype
Timeline for d4zrka1: