Lineage for d1avda_ (1avd A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62326Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 62327Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 62328Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 62329Protein Avidin [50880] (1 species)
  7. 62330Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)
  8. 62339Domain d1avda_: 1avd A: [27413]

Details for d1avda_

PDB Entry: 1avd (more details), 2.7 Å

PDB Description: three-dimensional structure of the tetragonal crystal form of egg- white avidin in its functional complex with biotin at 2.7 angstroms resolution

SCOP Domain Sequences for d1avda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avda_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

SCOP Domain Coordinates for d1avda_:

Click to download the PDB-style file with coordinates for d1avda_.
(The format of our PDB-style files is described here.)

Timeline for d1avda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1avdb_