Lineage for d4zrkc1 (4zrk C:19-103)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178913Species Mouse (Mus musculus) [TaxId:10090] [189205] (11 PDB entries)
  8. 2178956Domain d4zrkc1: 4zrk C:19-103 [274123]
    Other proteins in same PDB: d4zrka2, d4zrka3, d4zrkb2, d4zrkb3, d4zrkc2, d4zrkc3, d4zrkd2, d4zrkd3
    automated match to d1h4ra3

Details for d4zrkc1

PDB Entry: 4zrk (more details), 2.32 Å

PDB Description: merlin-ferm and lats1 complex
PDB Compounds: (C:) merlin

SCOPe Domain Sequences for d4zrkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrkc1 d.15.1.0 (C:19-103) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd
kkvldhdvskeepvtfhflakfype

SCOPe Domain Coordinates for d4zrkc1:

Click to download the PDB-style file with coordinates for d4zrkc1.
(The format of our PDB-style files is described here.)

Timeline for d4zrkc1: