SCOPe 2.05: Domain d2avib_: 2avi B:

Lineage for d2avib_ (2avi B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)

8. Domain d2avib_: 2avi B: [27412]
   complexed with btn, ndg

Details for d2avib_

PDB Entry: 2avi, 3 Å

PDB Description: three-dimensional structures of avidin and the avidin-biotin complex

PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d2avib_:

Sequence; same for both SEQRES and ATOM records:

>d2avib_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d2avib_:

• d2avib_ first appeared (with stable ids) in SCOP 1.55
  
• d2avib_ appears in SCOPe 2.04
  
• d2avib_ appears in SCOPe 2.06
  
• d2avib_ appears in the current release, SCOPe 2.08