Lineage for d2avib_ (2avi B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674119Protein Avidin [50880] (1 species)
  7. 674120Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)
  8. 674140Domain d2avib_: 2avi B: [27412]
    complexed with btn, nag

Details for d2avib_

PDB Entry: 2avi (more details), 3 Å

PDB Description: three-dimensional structures of avidin and the avidin-biotin complex
PDB Compounds: (B:) Avidin

SCOP Domain Sequences for d2avib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avib_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOP Domain Coordinates for d2avib_:

Click to download the PDB-style file with coordinates for d2avib_.
(The format of our PDB-style files is described here.)

Timeline for d2avib_: