Lineage for d2avib_ (2avi B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.61: Streptavidin-like [50875] (3 superfamilies) Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) 
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) 
Protein Avidin [50880] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50881] (5 PDB entries) 
Domain d2avib_: 2avi B: [27412]
Details for d2avib_
PDB Entry: 2avi (more details), 3 Å
PDB Description: three-dimensional structures of avidin and the avidin-biotin complex
SCOP Domain Sequences for d2avib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avib_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l
SCOP Domain Coordinates for d2avib_:
Click to download the PDB-style file with coordinates for d2avib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2avib_:
- d2avib_ appears in SCOP 1.57
- d2avib_ appears in the current release, SCOPe 2.08
View in 3D
