Lineage for d4zqpa_ (4zqp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080817Species Mycobacterium tuberculosis [TaxId:83332] [274113] (7 PDB entries)
  8. 2080824Domain d4zqpa_: 4zqp A: [274119]
    automated match to d4myxe_
    complexed with gol, imp, k, kp3, pgo, po4

Details for d4zqpa_

PDB Entry: 4zqp (more details), 1.9 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from mycobacterium tuberculosis in the complex with imp and the inhibitor mad1
PDB Compounds: (A:) Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4zqpa_:

Sequence, based on SEQRES records: (download)

>d4zqpa_ c.1.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dpvptggddphkvamlgltfddvlllpaasdvvpatadtssqltkkirlkvplvssamdt
vtesrmaiamaraggmgvlhrnlpvaeqagqvemvkrsggllvgaavgvggdawvramml
vdagvdvlvvdtahahnrlvldmvgklksevgdrvevvggnvatrsaaaalvdagadavk
vgvgpgsicttrvvagvgapqitaileavaacrpagvpviadgglqysgdiakalaagas
tamlgsllagtaeapgelifvngkqyksyrgmgslgamrgrggatsyskdryfaddalse
dklvpegiegrvpfrgplssvihqltgglraamgytgsptievlqqaqfvritpaglkes
hphdvamtveapnyya

Sequence, based on observed residues (ATOM records): (download)

>d4zqpa_ c.1.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dpvptggddphkvamlgltfddvlllpaasdvvpatadtssqltkkirlkvplvssamdt
vtesrmaiamaraggmgvlhrnlpvaeqagqvemvkrsggllvgaavgvggdawvramml
vdagvdvlvvdtahahnrlvldmvgklksevgdrvevvggnvatrsaaaalvdagadavk
vgvgpgsicttrvvagvgapqitaileavaacrpagvpviadgglqysgdiakalaagas
tamlgsllagtaeapgelifvngkqyksyrgmgslgamrklvpegiegrvpfrgplssvi
hqltgglraamgytgsptievlqqaqfvritpaglkeshphdvamtveapnyya

SCOPe Domain Coordinates for d4zqpa_:

Click to download the PDB-style file with coordinates for d4zqpa_.
(The format of our PDB-style files is described here.)

Timeline for d4zqpa_: