| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
| Protein automated matches [191142] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
| Domain d4zomc_: 4zom C: [274112] automated match to d4nb6b_ complexed with 4q3 |
PDB Entry: 4zom (more details), 2.27 Å
SCOPe Domain Sequences for d4zomc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zomc_ a.123.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhltea
iqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmel
fralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynle
lafhhhlckthrqsilaklppkgklrslcsqhverlqif
Timeline for d4zomc_: