Lineage for d2avia_ (2avi A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806368Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 806369Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 806370Protein Avidin [50880] (1 species)
  7. 806371Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)
  8. 806390Domain d2avia_: 2avi A: [27411]

Details for d2avia_

PDB Entry: 2avi (more details), 3 Å

PDB Description: three-dimensional structures of avidin and the avidin-biotin complex
PDB Compounds: (A:) Avidin

SCOP Domain Sequences for d2avia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avia_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOP Domain Coordinates for d2avia_:

Click to download the PDB-style file with coordinates for d2avia_.
(The format of our PDB-style files is described here.)

Timeline for d2avia_: