SCOP 1.71: Domain d2avia_: 2avi A:

Lineage for d2avia_ (2avi A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.61: Streptavidin-like [50875] (6 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)

8. Domain d2avia_: 2avi A: [27411]

Details for d2avia_

PDB Entry: 2avi, 3 Å

PDB Description: three-dimensional structures of avidin and the avidin-biotin complex

SCOP Domain Sequences for d2avia_:

Sequence; same for both SEQRES and ATOM records:

>d2avia_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d2avia_:

• d2avia_ first appeared (with stable ids) in SCOP 1.55
  
• d2avia_ appears in SCOP 1.69
  
• d2avia_ appears in SCOP 1.73
  
• d2avia_ appears in the current release, SCOPe 2.08