SCOPe 2.08: Domain d4zjrd1: 4zjr D:1-481

Lineage for d4zjrd1 (4zjr D:1-481)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d4zjrd1: 4zjr D:1-481 [274104]
   Other proteins in same PDB: d4zjrc2, d4zjrd2
   automated match to d4nb6b_
   complexed with 4p3

Details for d4zjrd1

PDB Entry: 4zjr, 2.7 Å

PDB Description: rorgamma in complex with inverse agonist 48

PDB Compounds: (D:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4zjrd1:

Sequence; same for both SEQRES and ATOM records:

>d4zjrd1 a.123.1.0 (D:1-481) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhve

Timeline for d4zjrd1:

• d4zjrd1 first appeared in SCOPe 2.05, called d4zjrd_
  
• d4zjrd1 appears in SCOPe 2.07