Lineage for d4zjrd1 (4zjr D:1-481)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (62 PDB entries)
  8. 2336557Domain d4zjrd1: 4zjr D:1-481 [274104]
    Other proteins in same PDB: d4zjrc2, d4zjrd2
    automated match to d4nb6b_
    complexed with 4p3

Details for d4zjrd1

PDB Entry: 4zjr (more details), 2.7 Å

PDB Description: rorgamma in complex with inverse agonist 48
PDB Compounds: (D:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4zjrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zjrd1 a.123.1.0 (D:1-481) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhve

SCOPe Domain Coordinates for d4zjrd1:

Click to download the PDB-style file with coordinates for d4zjrd1.
(The format of our PDB-style files is described here.)

Timeline for d4zjrd1: