![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
![]() | Protein automated matches [190558] (13 species) not a true protein |
![]() | Species Ixodes scapularis [TaxId:6945] [255931] (3 PDB entries) |
![]() | Domain d4zm8c_: 4zm8 C: [274102] automated match to d3lh4a_ |
PDB Entry: 4zm8 (more details), 2.68 Å
SCOPe Domain Sequences for d4zm8c_:
Sequence, based on SEQRES records: (download)
>d4zm8c_ d.17.1.0 (C:) automated matches {Ixodes scapularis [TaxId: 6945]} fggyseranhqanpeflnlahyatstwsaqqpgkthfdtvaevvkvetqvvagtnyrltl kvaestceltstynkdtclpkadaahrtcttvvfenlqgdksvspfeceaa
>d4zm8c_ d.17.1.0 (C:) automated matches {Ixodes scapularis [TaxId: 6945]} fggyserhqanpeflnlahyatstwsaqqpgkthfdtvaevvkvetqvvagtnyrltlkv aestceltstynkdtclpkadaahrtcttvvfenlqgdksvspfeceaa
Timeline for d4zm8c_: