Lineage for d1ravb_ (1rav B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 958656Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 958657Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 958658Protein Avidin [50880] (1 species)
  7. 958659Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)
  8. 958669Domain d1ravb_: 1rav B: [27410]

Details for d1ravb_

PDB Entry: 1rav (more details), 2.2 Å

PDB Description: recombinant avidin
PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d1ravb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ravb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt

SCOPe Domain Coordinates for d1ravb_:

Click to download the PDB-style file with coordinates for d1ravb_.
(The format of our PDB-style files is described here.)

Timeline for d1ravb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rava_