SCOP 1.61: Domain d1ravb_: 1rav B:

Lineage for d1ravb_ (1rav B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)

8. Domain d1ravb_: 1rav B: [27410]

Details for d1ravb_

PDB Entry: 1rav, 2.2 Å

PDB Description: recombinant avidin

SCOP Domain Sequences for d1ravb_:

Sequence; same for both SEQRES and ATOM records:

>d1ravb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt

Timeline for d1ravb_:

• d1ravb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ravb_ appears in SCOP 1.59
  
• d1ravb_ appears in SCOP 1.63
  
• d1ravb_ appears in the current release, SCOPe 2.08