SCOPe 2.05: Domain d4zafa_: 4zaf A:

Lineage for d4zafa_ (4zaf A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families)

5. Family c.34.1.0: automated matches [191535] (1 protein)
   not a true family

6. Protein automated matches [190910] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [189793] (9 PDB entries)

8. Domain d4zafa_: 4zaf A: [274096]
   automated match to d3zqua_
   complexed with 4lr, fmn, k, scn

Details for d4zafa_

PDB Entry: 4zaf, 1.71 Å

PDB Description: structure of ubix in complex with oxidised fmn and dimethylallyl monophosphate

PDB Compounds: (A:) Probable aromatic acid decarboxylase

SCOPe Domain Sequences for d4zafa_:

Sequence; same for both SEQRES and ATOM records:

>d4zafa_ c.34.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
fvvarilntlgipqdmlprwgeqhlvs

Timeline for d4zafa_:

• d4zafa_ is new in SCOPe 2.05-stable
  
• d4zafa_ appears in SCOPe 2.06
  
• d4zafa_ appears in the current release, SCOPe 2.08