Lineage for d1rava_ (1rav A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113687Fold b.61: Streptavidin-like [50875] (4 superfamilies)
  4. 113688Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 113689Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 113690Protein Avidin [50880] (1 species)
  7. 113691Species Chicken (Gallus gallus) [TaxId:9031] [50881] (6 PDB entries)
  8. 113696Domain d1rava_: 1rav A: [27409]

Details for d1rava_

PDB Entry: 1rav (more details), 2.2 Å

PDB Description: recombinant avidin

SCOP Domain Sequences for d1rava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rava_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rlrt

SCOP Domain Coordinates for d1rava_:

Click to download the PDB-style file with coordinates for d1rava_.
(The format of our PDB-style files is described here.)

Timeline for d1rava_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ravb_