Lineage for d2camb_ (2cam B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378912Fold b.61: Streptavidin-like [50875] (6 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 378913Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 378914Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 378915Protein Avidin [50880] (1 species)
  7. 378916Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)
  8. 378922Domain d2camb_: 2cam B: [27408]
    mutant

Details for d2camb_

PDB Entry: 2cam (more details), 2.2 Å

PDB Description: avidin mutant (k3e,k9e,r26d,r124l)

SCOP Domain Sequences for d2camb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2camb_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus)}
recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rllt

SCOP Domain Coordinates for d2camb_:

Click to download the PDB-style file with coordinates for d2camb_.
(The format of our PDB-style files is described here.)

Timeline for d2camb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cama_