Lineage for d2cama_ (2cam A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806368Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 806369Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 806370Protein Avidin [50880] (1 species)
  7. 806371Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)
  8. 806380Domain d2cama_: 2cam A: [27407]

Details for d2cama_

PDB Entry: 2cam (more details), 2.2 Å

PDB Description: avidin mutant (k3e,k9e,r26d,r124l)
PDB Compounds: (A:) Avidin

SCOP Domain Sequences for d2cama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cama_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rllt

SCOP Domain Coordinates for d2cama_:

Click to download the PDB-style file with coordinates for d2cama_.
(The format of our PDB-style files is described here.)

Timeline for d2cama_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2camb_