Lineage for d2cama_ (2cam A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16670Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 16671Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 16672Protein Avidin [50880] (1 species)
  7. 16673Species Chicken (Gallus gallus) [TaxId:9031] [50881] (5 PDB entries)
  8. 16674Domain d2cama_: 2cam A: [27407]

Details for d2cama_

PDB Entry: 2cam (more details), 2.2 Å

PDB Description: avidin mutant (k3e,k9e,r26d,r124l)

SCOP Domain Sequences for d2cama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cama_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus)}
recsltgewtndlgsnmtigavnsdgeftgtyitavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rllt

SCOP Domain Coordinates for d2cama_:

Click to download the PDB-style file with coordinates for d2cama_.
(The format of our PDB-style files is described here.)

Timeline for d2cama_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2camb_